PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g028450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25861.9 Da    PI: 9.5844
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g028450.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.64.4e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++gklye+ss
  Sopen08g028450.1  9 KRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSS 59
                      79***********************************************96 PP

2K-box62.31.8e-21881741399
             K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       ++e+l++e+a + +++e L+ ++R+llG +Les ++ eLqq+e+qLeksl++i+++Kn +++eqi +l++ ek l +en +L+kk e
  Sopen08g028450.1  88 TTEHLKEEVATMTRKLEFLEDSKRKLLGHGLESSTFDELQQVEEQLEKSLSNIKARKNLFFKEQIAQLKEEEKILLKENVDLKKKCE 174
                       6899********************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.735161IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-32373IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002657.20E-43375No hitNo description
PfamPF003196.8E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014869.3E-2288174IPR002487Transcription factor, K-box
PROSITE profilePS5129713.21889179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MVRGKTELKR IENATSRQVT FSKRRSGLLK KAFELSVLCD AEVALIVFSP KGKLYEFSSS  60
STNKTIERYQ KNEKSLGRLN RKLTDQLTTE HLKEEVATMT RKLEFLEDSK RKLLGHGLES  120
STFDELQQVE EQLEKSLSNI KARKNLFFKE QIAQLKEEEK ILLKENVDLK KKCEVLPLTL  180
KPVPQVEKDV ERQIMEVETE LFIGLPETRK SSYCPNLNTL PTSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-18387287Myocyte-specific enhancer factor 2A
3kov_B1e-18387287Myocyte-specific enhancer factor 2A
3kov_I1e-18387287Myocyte-specific enhancer factor 2A
3kov_J1e-18387287Myocyte-specific enhancer factor 2A
3p57_A1e-18387287Myocyte-specific enhancer factor 2A
3p57_B1e-18387287Myocyte-specific enhancer factor 2A
3p57_C1e-18387287Myocyte-specific enhancer factor 2A
3p57_D1e-18387287Myocyte-specific enhancer factor 2A
3p57_I1e-18387287Myocyte-specific enhancer factor 2A
3p57_J1e-18387287Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2441952e-96AC244195.1 Solanum lycopersicum strain Heinz 1706 chromosome 8 clone hba-6a9 map 8, complete sequence.
GenBankHG9754472e-96HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755202e-96HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083980.11e-159PREDICTED: agamous-like MADS-box protein AGL19
SwissprotO827432e-73AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLK4CP101e-153K4CP10_SOLLC; Uncharacterized protein
STRINGSolyc08g080100.2.11e-153(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.11e-68AGAMOUS-like 19